PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG019255.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 221aa    MW: 25529.3 Da    PI: 7.0988
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG019255.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.18.3e-08752346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +W+  Ed+++ +a  +++ +   +W++I+++++ g++  +++ ++ +
      CCG019255.1  7 SWSRLEDKQFEQALVLFPEEtpkRWEKISSYVP-GKSWREVRKHYED 52
                     6*****************99*************.***********76 PP

2Myb_DNA-binding43.95.6e-14105149347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +++G+g+W++I+r     Rt+ q+ s+ qky
      CCG019255.1 105 PWTEEEHRLFLIGLQKYGKGDWRSISRNAVVSRTPTQVASHAQKY 149
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.456158IPR017930Myb domain
SMARTSM007171.6E-9456IPR001005SANT/Myb domain
SuperFamilySSF466892.97E-11762IPR009057Homeodomain-like
PfamPF002497.4E-7753IPR001005SANT/Myb domain
CDDcd001673.72E-7754No hitNo description
PROSITE profilePS5129419.44598154IPR017930Myb domain
SuperFamilySSF466894.9E-1799155IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-17102152IPR006447Myb domain, plants
SMARTSM007171.2E-10102152IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-12102148IPR009057Homeodomain-like
CDDcd001673.90E-9105150No hitNo description
PfamPF002491.4E-11105149IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MSSHLSSWSR LEDKQFEQAL VLFPEETPKR WEKISSYVPG KSWREVRKHY EDLVHDVLEI  60
DSGRVEVPVY DQDELWGDST TSFGAAAEPR SGKEREHTER RKGTPWTEEE HRLFLIGLQK  120
YGKGDWRSIS RNAVVSRTPT QVASHAQKYF LRLNSVKKEK KRSSIHDITA TNATHSTAQT  180
NHDPIWNFEL MDQSVDALSR PANFFHDQGN PPAYQGFGFP M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-138701173RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011006061.11e-166PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H73e-55DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLB9GI071e-128B9GI07_POPTR; Uncharacterized protein
STRINGPOPTR_0001s22660.17e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-72MYB family protein